GridJsObject is not defined when add grid seriallize inside Grid UIMagento 2 admin ui grid callbacksAdd to cart error : ReferenceError: productAddToCartForm is not definedAdding a grid/table inside grid in Magento AdminMagento2 override admin js fileReferenceError: Flex is not definedForm Grid serializerController can't render my column value when loadvarienForm is not definedDynamicRows - underscore's function last() is not definedMagento 2 Grid serialization : not getting selected product idIScroll not defined when loading with RequireJS?UiComponent replacement for MagentoBackendBlockWidgetGridSerializer

how to modify custom status text color in UI component grid magento 2?

Is divide-by-zero a security vulnerability?

Why restrict private health insurance?

What are some noteworthy "mic-drop" moments in math?

Do I really need to have a scientific explanation for my premise?

What problems would a superhuman have whose skin is constantly hot?

Are all players supposed to be able to see each others' character sheets?

Has a sovereign Communist government ever run, and conceded loss, on a fair election?

I can't die. Who am I?

Expressing logarithmic equations without logs

Can one live in the U.S. and not use a credit card?

What is Earthy controling in the ISS cupola?

Haman going to the second feast dirty

Can we track matter through time by looking at different depths in space?

Does an unused member variable take up memory?

Is it possible that a question has only two answers?

How does Ehrenfest's theorem apply to the quantum harmonic oscillator?

Is it possible to avoid unpacking when merging Association?

Did Amazon pay $0 in taxes last year?

Crossing a border with an infant of a different citizenship

How exactly does an Ethernet collision happen in the cable, since nodes use different circuits for Tx and Rx?

Can I use a violin G string for D?

Why is a very small peak with larger m/z not considered to be the molecular ion?

Does a difference of tense count as a difference of meaning in a minimal pair?



GridJsObject is not defined when add grid seriallize inside Grid UI


Magento 2 admin ui grid callbacksAdd to cart error : ReferenceError: productAddToCartForm is not definedAdding a grid/table inside grid in Magento AdminMagento2 override admin js fileReferenceError: Flex is not definedForm Grid serializerController can't render my column value when loadvarienForm is not definedDynamicRows - underscore's function last() is not definedMagento 2 Grid serialization : not getting selected product idIScroll not defined when loading with RequireJS?UiComponent replacement for MagentoBackendBlockWidgetGridSerializer













0















I have face with this error while creat grid seriallize render data inside Grid parent. It build in by Grid UI Component. I dont use old way like magento 1. When click on edit tab to trigger ajax render grid. Console rise undefined JSObject. How to fix it and define missing object? Why it could happen



grid render by component grid follow path below but i don't understand it fully




libwebmageadminhtmlgrid.js











share|improve this question














bumped to the homepage by Community 41 mins ago


This question has answers that may be good or bad; the system has marked it active so that they can be reviewed.










  • 3





    Possible duplicate of Magento 2 admin ui grid callbacks

    – Teja Bhagavan Kollepara
    May 8 '17 at 12:40















0















I have face with this error while creat grid seriallize render data inside Grid parent. It build in by Grid UI Component. I dont use old way like magento 1. When click on edit tab to trigger ajax render grid. Console rise undefined JSObject. How to fix it and define missing object? Why it could happen



grid render by component grid follow path below but i don't understand it fully




libwebmageadminhtmlgrid.js











share|improve this question














bumped to the homepage by Community 41 mins ago


This question has answers that may be good or bad; the system has marked it active so that they can be reviewed.










  • 3





    Possible duplicate of Magento 2 admin ui grid callbacks

    – Teja Bhagavan Kollepara
    May 8 '17 at 12:40













0












0








0


1






I have face with this error while creat grid seriallize render data inside Grid parent. It build in by Grid UI Component. I dont use old way like magento 1. When click on edit tab to trigger ajax render grid. Console rise undefined JSObject. How to fix it and define missing object? Why it could happen



grid render by component grid follow path below but i don't understand it fully




libwebmageadminhtmlgrid.js











share|improve this question














I have face with this error while creat grid seriallize render data inside Grid parent. It build in by Grid UI Component. I dont use old way like magento 1. When click on edit tab to trigger ajax render grid. Console rise undefined JSObject. How to fix it and define missing object? Why it could happen



grid render by component grid follow path below but i don't understand it fully




libwebmageadminhtmlgrid.js








magento2 javascript grid-serlization uicomponent






share|improve this question













share|improve this question











share|improve this question




share|improve this question










asked Jun 17 '16 at 19:54









mrtuvnmrtuvn

1,8341729




1,8341729





bumped to the homepage by Community 41 mins ago


This question has answers that may be good or bad; the system has marked it active so that they can be reviewed.







bumped to the homepage by Community 41 mins ago


This question has answers that may be good or bad; the system has marked it active so that they can be reviewed.









  • 3





    Possible duplicate of Magento 2 admin ui grid callbacks

    – Teja Bhagavan Kollepara
    May 8 '17 at 12:40












  • 3





    Possible duplicate of Magento 2 admin ui grid callbacks

    – Teja Bhagavan Kollepara
    May 8 '17 at 12:40







3




3





Possible duplicate of Magento 2 admin ui grid callbacks

– Teja Bhagavan Kollepara
May 8 '17 at 12:40





Possible duplicate of Magento 2 admin ui grid callbacks

– Teja Bhagavan Kollepara
May 8 '17 at 12:40










1 Answer
1






active

oldest

votes


















0














I found my problem. Somehow GridJsObject missing because template not render successful.

In Magento 2 grid in backend render by grid.js widget.

Location of file in libwebmageadminhtmlgrid.js.
File vendormagentomodule-backendviewadminhtmltemplateswidgetgrid.phtml responsibility for render template. Inside this template you will find



deps.push('mage/adminhtml/grid'); for call widget


This line in 164-187 for creat GridJsObject by Object varienGrid



<?php /* @escapeNotVerified */ echo $block->getJsObjectName() ?> = new varienGrid('<?php echo $block->escapeHtml($block->getId()) ?>', '<?php /* @escapeNotVerified */ echo $block->getGridUrl() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNamePage() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameSort() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameDir() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameFilter() ?>');


Grid missing by template not render






share|improve this answer






















    Your Answer








    StackExchange.ready(function()
    var channelOptions =
    tags: "".split(" "),
    id: "479"
    ;
    initTagRenderer("".split(" "), "".split(" "), channelOptions);

    StackExchange.using("externalEditor", function()
    // Have to fire editor after snippets, if snippets enabled
    if (StackExchange.settings.snippets.snippetsEnabled)
    StackExchange.using("snippets", function()
    createEditor();
    );

    else
    createEditor();

    );

    function createEditor()
    StackExchange.prepareEditor(
    heartbeatType: 'answer',
    autoActivateHeartbeat: false,
    convertImagesToLinks: false,
    noModals: true,
    showLowRepImageUploadWarning: true,
    reputationToPostImages: null,
    bindNavPrevention: true,
    postfix: "",
    imageUploader:
    brandingHtml: "Powered by u003ca class="icon-imgur-white" href="https://imgur.com/"u003eu003c/au003e",
    contentPolicyHtml: "User contributions licensed under u003ca href="https://creativecommons.org/licenses/by-sa/3.0/"u003ecc by-sa 3.0 with attribution requiredu003c/au003e u003ca href="https://stackoverflow.com/legal/content-policy"u003e(content policy)u003c/au003e",
    allowUrls: true
    ,
    onDemand: true,
    discardSelector: ".discard-answer"
    ,immediatelyShowMarkdownHelp:true
    );



    );













    draft saved

    draft discarded


















    StackExchange.ready(
    function ()
    StackExchange.openid.initPostLogin('.new-post-login', 'https%3a%2f%2fmagento.stackexchange.com%2fquestions%2f121478%2fgridjsobject-is-not-defined-when-add-grid-seriallize-inside-grid-ui%23new-answer', 'question_page');

    );

    Post as a guest















    Required, but never shown

























    1 Answer
    1






    active

    oldest

    votes








    1 Answer
    1






    active

    oldest

    votes









    active

    oldest

    votes






    active

    oldest

    votes









    0














    I found my problem. Somehow GridJsObject missing because template not render successful.

    In Magento 2 grid in backend render by grid.js widget.

    Location of file in libwebmageadminhtmlgrid.js.
    File vendormagentomodule-backendviewadminhtmltemplateswidgetgrid.phtml responsibility for render template. Inside this template you will find



    deps.push('mage/adminhtml/grid'); for call widget


    This line in 164-187 for creat GridJsObject by Object varienGrid



    <?php /* @escapeNotVerified */ echo $block->getJsObjectName() ?> = new varienGrid('<?php echo $block->escapeHtml($block->getId()) ?>', '<?php /* @escapeNotVerified */ echo $block->getGridUrl() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNamePage() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameSort() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameDir() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameFilter() ?>');


    Grid missing by template not render






    share|improve this answer



























      0














      I found my problem. Somehow GridJsObject missing because template not render successful.

      In Magento 2 grid in backend render by grid.js widget.

      Location of file in libwebmageadminhtmlgrid.js.
      File vendormagentomodule-backendviewadminhtmltemplateswidgetgrid.phtml responsibility for render template. Inside this template you will find



      deps.push('mage/adminhtml/grid'); for call widget


      This line in 164-187 for creat GridJsObject by Object varienGrid



      <?php /* @escapeNotVerified */ echo $block->getJsObjectName() ?> = new varienGrid('<?php echo $block->escapeHtml($block->getId()) ?>', '<?php /* @escapeNotVerified */ echo $block->getGridUrl() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNamePage() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameSort() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameDir() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameFilter() ?>');


      Grid missing by template not render






      share|improve this answer

























        0












        0








        0







        I found my problem. Somehow GridJsObject missing because template not render successful.

        In Magento 2 grid in backend render by grid.js widget.

        Location of file in libwebmageadminhtmlgrid.js.
        File vendormagentomodule-backendviewadminhtmltemplateswidgetgrid.phtml responsibility for render template. Inside this template you will find



        deps.push('mage/adminhtml/grid'); for call widget


        This line in 164-187 for creat GridJsObject by Object varienGrid



        <?php /* @escapeNotVerified */ echo $block->getJsObjectName() ?> = new varienGrid('<?php echo $block->escapeHtml($block->getId()) ?>', '<?php /* @escapeNotVerified */ echo $block->getGridUrl() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNamePage() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameSort() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameDir() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameFilter() ?>');


        Grid missing by template not render






        share|improve this answer













        I found my problem. Somehow GridJsObject missing because template not render successful.

        In Magento 2 grid in backend render by grid.js widget.

        Location of file in libwebmageadminhtmlgrid.js.
        File vendormagentomodule-backendviewadminhtmltemplateswidgetgrid.phtml responsibility for render template. Inside this template you will find



        deps.push('mage/adminhtml/grid'); for call widget


        This line in 164-187 for creat GridJsObject by Object varienGrid



        <?php /* @escapeNotVerified */ echo $block->getJsObjectName() ?> = new varienGrid('<?php echo $block->escapeHtml($block->getId()) ?>', '<?php /* @escapeNotVerified */ echo $block->getGridUrl() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNamePage() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameSort() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameDir() ?>', '<?php /* @escapeNotVerified */ echo $block->getVarNameFilter() ?>');


        Grid missing by template not render







        share|improve this answer












        share|improve this answer



        share|improve this answer










        answered Jun 18 '16 at 9:29









        mrtuvnmrtuvn

        1,8341729




        1,8341729



























            draft saved

            draft discarded
















































            Thanks for contributing an answer to Magento Stack Exchange!


            • Please be sure to answer the question. Provide details and share your research!

            But avoid


            • Asking for help, clarification, or responding to other answers.

            • Making statements based on opinion; back them up with references or personal experience.

            To learn more, see our tips on writing great answers.




            draft saved


            draft discarded














            StackExchange.ready(
            function ()
            StackExchange.openid.initPostLogin('.new-post-login', 'https%3a%2f%2fmagento.stackexchange.com%2fquestions%2f121478%2fgridjsobject-is-not-defined-when-add-grid-seriallize-inside-grid-ui%23new-answer', 'question_page');

            );

            Post as a guest















            Required, but never shown





















































            Required, but never shown














            Required, but never shown












            Required, but never shown







            Required, but never shown

































            Required, but never shown














            Required, but never shown












            Required, but never shown







            Required, but never shown







            Popular posts from this blog

            Nidaros erkebispedøme

            六本木駅

            Show that the multivalued-function $sqrt{z^2-25}$ has an analytic branch in the domain $Bbb Csetminus...